Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB02688"

PredicateValue (sorted: default)
rdfs:label
"2,3-Didehydroalanine"
rdf:type
drugbank:description
" 1948-56-7 experimental This compound belongs to the alpha amino acids and derivatives. These are amino acids in which the amino group is attached to the carbon atom immediately adjacent to the carboxylate group (alpha carbon), or a derivative thereof. Alpha Amino Acids and Derivatives Organic Compounds Organic Acids and Derivatives Carboxylic Acids and Derivatives Amino Acids, Peptides, and Analogues Enones Enolates Polyamines Enamines Carboxylic Acids enone enolate enamine carboxylic acid polyamine amine organonitrogen compound logP -0.13 ALOGPS logS 0.43 ALOGPS Water Solubility 2.33e+02 g/l ALOGPS logP -2.9 ChemAxon IUPAC Name 2-aminoprop-2-enoic acid ChemAxon Traditional IUPAC Name 2,3-didehydroalanine ChemAxon Molecular Weight 87.0773 ChemAxon Monoisotopic Weight 87.032028409 ChemAxon SMILES NC(=C)C(O)=O ChemAxon Molecular Formula C3H5NO2 ChemAxon InChI InChI=1S/C3H5NO2/c1-2(4)3(5)6/h1,4H2,(H,5,6) ChemAxon InChIKey InChIKey=UQBOJOOOTLPNST-UHFFFAOYSA-N ChemAxon Polar Surface Area (PSA) 63.32 ChemAxon Refractivity 20.92 ChemAxon Polarizability 7.72 ChemAxon Rotatable Bond Count 1 ChemAxon H Bond Acceptor Count 3 ChemAxon H Bond Donor Count 2 ChemAxon pKa (strongest acidic) 2.58 ChemAxon pKa (strongest basic) 8.64 ChemAxon Physiological Charge 0 ChemAxon Number of Rings 0 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon ChEBI 17123 PubChem Compound 123991 PubChem Substance 46509183 KEGG Compound C02218 ChemSpider 110510 PDB DHA BE0002667 Lantibiotic mersacidin Bacillus sp. (strain HIL-Y85/54728) unknown Lantibiotic mersacidin Kills a number of Gram-positive bacteria. Acts at the level of cell wall biosynthesis by interfering with bacterial peptidoglycan biosynthesis. Specifically inhibits the conversion of the lipid II intermediate into polymeric nascent glycan strands by transglycosylation. May interact with the peptidoglycan precursor rather than with the enzyme mrsA None 4.17 7228.0 Bacillus sp. (strain HIL-Y85/54728) GenBank Gene Database Z47559 UniProtKB P43683 UniProt Accession MRSA_BACSY Lantibiotic mersacidin precursor >Lantibiotic mersacidin MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVC TLTSECIC >207 bp ATGAGTCAAGAAGCTATCATTCGTTCATGGAAAGATCCTTTTTCCCGTGAAAATTCTACA CAAAATCCAGCTGGTAACCCATTCAGTGAGCTGAAAGAAGCACAAATGGATAAGTTAGTA GGTGCGGGAGACATGGAAGCAGCATGTACTTTTACATTGCCTGGTGGCGGCGGTGTTTGT ACTCTAACTTCTGAATGTATTTGTTAA "
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines2/drugbank_small.nt

The resource does not appear as an object

Context graph