Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB03455"

PredicateValue (sorted: default)
rdfs:label
"(1h-Indol-3-Yl)-(2-Mercapto-Ethoxyimino)-Acetic Acid"
rdf:type
drugbank:description
" experimental This compound belongs to the indole-3-acetic acid derivatives. These are compounds containing an acetic acid (or a derivative) linked to the C3 carbon atom of an indole. Indole-3-acetic Acid Derivatives Organic Compounds Heterocyclic Compounds Indoles and Derivatives Indolyl Carboxylic Acids and Derivatives Alpha Amino Acids and Derivatives Indoles Substituted Pyrroles Benzene and Substituted Derivatives Enolates Carboxylic Acids Polyamines Alkylthiols alpha-amino acid or derivative indole substituted pyrrole benzene pyrrole alkylthiol polyamine enolate carboxylic acid derivative carboxylic acid amine organonitrogen compound logP 1.27 ALOGPS logS -3.4 ALOGPS Water Solubility 1.06e-01 g/l ALOGPS logP 1.42 ChemAxon IUPAC Name (2R)-2-(1H-indol-3-yl)-2-[(2-sulfanylethoxy)amino]acetic acid ChemAxon Traditional IUPAC Name (R)-1H-indol-3-yl[(2-sulfanylethoxy)amino]acetic acid ChemAxon Molecular Weight 266.316 ChemAxon Monoisotopic Weight 266.072513014 ChemAxon SMILES [H][C@](NOCCS)(C(O)=O)C1=CNC2=C1C=CC=C2 ChemAxon Molecular Formula C12H14N2O3S ChemAxon InChI InChI=1S/C12H14N2O3S/c15-12(16)11(14-17-5-6-18)9-7-13-10-4-2-1-3-8(9)10/h1-4,7,11,13-14,18H,5-6H2,(H,15,16)/t11-/m1/s1 ChemAxon InChIKey InChIKey=FJAWIBGKKKXXAL-LLVKDONJSA-N ChemAxon Polar Surface Area (PSA) 74.35 ChemAxon Refractivity 80.66 ChemAxon Polarizability 27.27 ChemAxon Rotatable Bond Count 6 ChemAxon H Bond Acceptor Count 4 ChemAxon H Bond Donor Count 4 ChemAxon pKa (strongest acidic) 4.38 ChemAxon pKa (strongest basic) 2.65 ChemAxon Physiological Charge -1 ChemAxon Number of Rings 2 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon Ghose Filter true ChemAxon PubChem Compound 447066 PubChem Substance 46507395 ChemSpider 394263 PDB MPE BE0001029 Interleukin-2 Human # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Interleukin-2 Involved in interleukin-2 receptor binding Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells IL2 4q26-q27 Secreted protein None 7.95 17628.0 Human HUGO Gene Nomenclature Committee (HGNC) HGNC:6001 GenAtlas IL2 GeneCards IL2 GenBank Gene Database J00264 GenBank Protein Database 5729676 UniProtKB P60568 UniProt Accession IL2_HUMAN Aldesleukin IL-2 Interleukin-2 precursor T-cell growth factor TCGF >Interleukin-2 precursor MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT >462 bp ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGT GCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGAT TTACAGATGATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTC ACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTAGAA GAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTA AGACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAA ACAACATTCATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGA TGGATTACCTTTTGTCAAAGCATCATCTCAACACTGACTTGA PF00715 IL2 component extracellular region function growth factor activity function receptor binding function cytokine activity function hematopoietin/interferon-class (D200-domain) cytokine receptor binding function interleukin-2 receptor binding function signal transducer activity process response to stimulus process response to biotic stimulus process defense response process immune response "
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines2/drugbank_small.nt

The resource does not appear as an object

Context graph